DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and MASP1

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:556 Identity:131/556 - (23%)
Similarity:223/556 - (40%) Gaps:116/556 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LINSPYYPALYPVGTSCRYAVEAPKDHVLQFKCELQLRTLSTDLKCRTEV-----FHFNSEGDEV 95
            :|.||.:|..||..:.|.|.:|..:.    |...||...: .|::...||     :.....|.:|
Human   203 VITSPDFPNPYPKSSECLYTIELEEG----FMVNLQFEDI-FDIEDHPEVPCPYDYIKIKVGPKV 262

  Fly    96 LTSSEYFCGSGKFERKSFLNRAVISYISSGHSEPPSAVKLKDKLHAVPTTSTTTEAPQAVSIEEQ 160
            |..   |||....|..|..:.:|:....|.:|......:|..:       :...|.|        
Human   263 LGP---FCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYR-------AAGNECP-------- 309

  Fly   161 DAEEEQEEEEEPEEADEDLSDEVL-------HVLQDVGVSDALAYVASLLYDVEESRKSSTTIYL 218
            :.:.....:.||.:|.....|:||       .||:|....|  .:....|.|...|.|..|...:
Human   310 ELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMD--TFQIECLKDGTWSNKIPTCKIV 372

  Fly   219 D-KLP-------IRSSSKTSAKRARIVSSYPTAAP---SPGHGGGRFSCLVEAF---------QP 263
            | :.|       |..|::.:....:....|....|   ...:..|.::|..:..         .|
Human   373 DCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLP 437

  Fly   264 TC--SCGW------SRIPRIASPTNEEAVLHEFPPMAGVLTKKHGKV-----FCGAAIIHHRYLL 315
            ||  .||.      |.:.||....|.|..|  ||..|.::.:...:|     |...|::...::|
Human   438 TCLPECGQPSRSLPSLVKRIIGGRNAEPGL--FPWQALIVVEDTSRVPNDKWFGSGALLSASWIL 500

  Fly   316 SAAHCFLGPETN------SAAKLRVVVGEHDL---ASSFETFATQRYDLDALILHEDFSQASGQP 371
            :|||.......:      |...:.|.:|.||:   :.:..:.|.:      ::||.||:..:  .
Human   501 TAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAAR------VVLHPDFNIQN--Y 557

  Fly   372 KNDIAMLKTRMAIVWSQHVGPACLP-LQPGEDGQKLPLAGHQVVAAGWGTTS---------YGGP 426
            .:|||:::.:..:....||.|.||| |:|  :|....:.|   :.||||.::         ..|.
Human   558 NHDIALVQLQEPVPLGPHVMPVCLPRLEP--EGPAPHMLG---LVAGWGISNPNVTVDEIISSGT 617

  Fly   427 QT--HRLLKATLDVIDGRRCRQALSSAGG---LPPHTFCT--YTPGRDTCQYDSGGA--LYERIN 482
            :|  ..|....|.|:....|:.:..|..|   :..:.||.  |..|:|||..|||||  :::.::
Human   618 RTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLS 682

  Fly   483 GRLMAVGIVSFG--QACAAQQP-SVNTRVASFIKWI 515
            .|.:..|:||:|  :.|.::|. .|.|:|::::.|:
Human   683 QRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWV 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042 25/93 (27%)
Tryp_SPc 281..516 CDD:238113 70/271 (26%)
Tryp_SPc 281..515 CDD:214473 69/269 (26%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839 27/105 (26%)
Sushi 308..369 CDD:278512 15/70 (21%)
CCP 374..439 CDD:153056 8/64 (13%)
Tryp_SPc 456..718 CDD:214473 72/276 (26%)
Tryp_SPc 457..718 CDD:238113 71/275 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.