DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and PROC

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:356 Identity:87/356 - (24%)
Similarity:144/356 - (40%) Gaps:72/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 SKTSAKRARIVSSYPTAAPSPGHGGGRFSCLVEAFQPTCSCG----------------------- 268
            :.||..|..:.:.......|..:||....||.|.....|||.                       
Human   237 TSTSCPRPPLPAEVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRP 301

  Fly   269 WSRIPRIASPTNEEAVLHE----------------FPPMAGVLTKKHGKVFCGAAIIHHRYLLSA 317
            |.|:.:..|....:....|                ..|...||.....|:.|||.:||..::|:|
Human   302 WKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTA 366

  Fly   318 AHCFLGPETNSAAKLRVVVGEHDLASSFETFATQRYDLD----ALILHEDFSQASGQPKNDIAML 378
            |||.     :.:.||.|.:||:||.      ..::::||    .:.:|.::|:::  ..||||:|
Human   367 AHCM-----DESKKLLVRLGEYDLR------RWEKWELDLDIKEVFVHPNYSKST--TDNDIALL 418

  Fly   379 KTRMAIVWSQHVGPACLPLQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHR-----LLKATLDV 438
            ........||.:.|.||| ..|...::|..||.:.:..|||..|....:..|     |....:.|
Human   419 HLAQPATLSQTIVPICLP-DSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPV 482

  Fly   439 IDGRRCRQALSSAGGLPPHTFCTYTPG--RDTCQYDSGGALYERINGRLMAVGIVSFGQACA-AQ 500
            :....|.:.:|:.  :..:..|....|  :|.|:.||||.:....:|....||:||:|:.|. ..
Human   483 VPHNECSEVMSNM--VSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLH 545

  Fly   501 QPSVNTRVASFIKWIR-----TKSPEVAYCP 526
            ...|.|:|:.::.||.     .::|:.::.|
Human   546 NYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 69/262 (26%)
Tryp_SPc 281..515 CDD:214473 68/261 (26%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114 9/34 (26%)
Tryp_SPc 328..563 CDD:238113 69/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.