DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG11670

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:337 Identity:88/337 - (26%)
Similarity:132/337 - (39%) Gaps:82/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PTAAPSPGHGGGRFSCLVEAFQPTCSCGWSRIPRIASP--------------------------- 278
            |...|.||..||...       |.....|...||...|                           
  Fly   100 PPPGPPPGCPGGPGG-------PLQHRQWDNGPRQWQPRRPPPNHHRNFHNIFLNTESKVDGENY 157

  Fly   279 --TNEEAVLH------------EFPPMA--GVLTKKHGKVF-CGAAIIHHRYLLSAAHCFLGPET 326
              |.|...||            ::|.||  |...:.|...: ||.::|...::|:||||.   .|
  Fly   158 NKTAETEDLHDDFNGRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCL---TT 219

  Fly   327 NSAAKLRVVVGEHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVG 391
            :..:...|.:|:..|.......|.||..:..:.||..::.:...  :||.:::....:.::..|.
  Fly   220 HGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNY--HDIGLIQLNRPVEYTWFVR 282

  Fly   392 PACLPLQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGLPP 456
            |  :.|.|..|   :|..  ::...|:|:|.:..|||:.|.:..|.|:...:|..:|.:..| .|
  Fly   283 P--VRLWPMND---IPYG--KLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEG-SP 339

  Fly   457 HTFCT-------YTPGRDTCQYDSGGALY-----------ERINGRLMAVGIVSFGQACAAQQPS 503
            |...|       |...|||||.||||.|.           .|.:.|...|||.|:|..|.::.|.
  Fly   340 HGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCRSELPG 404

  Fly   504 VNTRVASFIKWI 515
            |.|||:|:|.||
  Fly   405 VYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 76/268 (28%)
Tryp_SPc 281..515 CDD:214473 74/266 (28%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 73/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.