DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG11668

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:285 Identity:84/285 - (29%)
Similarity:128/285 - (44%) Gaps:62/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 GGRFSCLVEAFQP-TCSCGWSRIPRIASPTNEEAVLHEFPPMAGVLTKKHGKVFCGAAIIHHRYL 314
            |||.:  .|...| .|:.||        |:.....:||...     :|:.....||.|:|..|:.
  Fly   150 GGRLT--QENEHPYMCALGW--------PSRTNRWIHEHGS-----SKRRYTFNCGCAMIAPRFA 199

  Fly   315 LSAAHC-FLGPETNSAAKLRVVVGEHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAML 378
            ::|||| .:|.|:.|.|    ::|..:|.|.    ..|..::..:..|..|...:  ..||:|::
  Fly   200 ITAAHCASVGGESPSVA----LIGGVELNSG----RGQLIEIKRISQHPHFDAET--LTNDLAVV 254

  Fly   379 KTR------MAIVWSQHVGPACLPLQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLD 437
            |..      :|.:|:|.    .||.:|             :.|.|:|.|.:.||.:..||:..|.
  Fly   255 KLARRSHMPVACLWNQE----SLPERP-------------LTALGYGQTKFAGPHSSNLLQIMLY 302

  Fly   438 VIDGRRCRQALSS----AGGLPPHTFCT--YTPGRDTCQYDSGGALYERINGR------LMAVGI 490
            .::.::|::.|.:    |.||.....|.  |:...||||.||||.|....:.|      ...|||
  Fly   303 HLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGI 367

  Fly   491 VSFGQACAAQQPSVNTRVASFIKWI 515
            .|||.|||:.||.|..|:|.:|:||
  Fly   368 TSFGGACASGQPGVYVRIAHYIQWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 75/254 (30%)
Tryp_SPc 281..515 CDD:214473 73/252 (29%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 84/285 (29%)
Tryp_SPc 149..392 CDD:214473 82/283 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.