DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG10041

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:306 Identity:71/306 - (23%)
Similarity:107/306 - (34%) Gaps:82/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 FQPTCSCGWSRIPRIASPTNEEAVLHEFPPMA---------------------GVLTKKHGKVFC 304
            :|..||..|......|..|..:...:..|.:|                     |...|.:.|..|
  Fly     4 WQSLCSIAWFAAMSAAQETLSDTPQNSTPLLATTVSTTKVISFRPRYPYIVSIGENLKGYYKHLC 68

  Fly   305 GAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHDLASSFET--FATQRYDLDALILHEDFSQA 367
            ...|:.:.::||||||.   :||...:|.|..|...|.|..:|  |..:|.      .|..|...
  Fly    69 VGVILSNEFVLSAAHCI---QTNPTKQLYVAGGADSLNSRKQTRFFVVERR------WHPQFRVL 124

  Fly   368 SGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGED---------GQKLPLAGHQVVAAGWGTTSY 423
            .|   ||||:|:              ..|..|.:|         |:....:|.|....|||....
  Fly   125 GG---NDIAVLR--------------IYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWGRVGV 172

  Fly   424 GGPQTHRLLKATLDVIDGRRCRQALSSAGGLPPHTFCTYTP----------GRDTCQYDSGGALY 478
            |  :..:|.:.....::...|:|:         |.|....|          .|..|..|||..|.
  Fly   173 G--KIRKLQEMPFLTMENDECQQS---------HRFVFLKPLDICAMHLKGPRGPCDGDSGAPLM 226

  Fly   479 ERINGRLMAVGIVSFG-QACAAQQPSVNTRVASFIKWIRTKSPEVA 523
            .....:|  .|::|:| :||...:|...||:.::..||:.....:|
  Fly   227 NVAKEKL--YGLLSYGRKACTPLKPYAFTRINAYSSWIQESMDSMA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 63/277 (23%)
Tryp_SPc 281..515 CDD:214473 62/276 (22%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 62/253 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.