DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG16749

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:263 Identity:72/263 - (27%)
Similarity:108/263 - (41%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SCGWSRIPRIASPTNEEAVLHEFP-PMAGVLTKKHGKVFCGAAIIHHRYLLSAAHCFLGPETNSA 329
            |.|..::.|:.:.|:.....:.|. .|.|    ..|...||.:||..:::::||||..|   ..|
  Fly    21 SHGAPQMGRVVNGTDSSVEKYPFVISMRG----SSGSHSCGGSIISKQFVMTAAHCTDG---RKA 78

  Fly   330 AKLRVVVGEHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVW-SQHVGPA 393
            :.|.|..|    .:...........:..:|.|||::..:.. .|||::|.......: ...|.|.
  Fly    79 SDLSVQYG----VTKINATGPNVVRVKKIIQHEDYNPYNNY-ANDISLLLVEEPFEFDGVTVAPV 138

  Fly   394 CLP----LQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGL 454
            .||    ..|..|      ||.:.|..|||..:.||.....|.:..|.|.....|.:   ..||.
  Fly   139 KLPELAFATPQTD------AGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTE---RHGGR 194

  Fly   455 --PPHTFC--TYTPGRDTCQYDSGGALYERINGRLMAVGIVSFG-QAC-AAQQPSVNTRVASFIK 513
              |.:..|  ....|:..|..||||.|.  .||:  .|||||:. :.| .|..|.|..:|:.::.
  Fly   195 TDPRYHICGGVDEGGKGQCSGDSGGPLI--YNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVD 255

  Fly   514 WIR 516
            ||:
  Fly   256 WIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 67/246 (27%)
Tryp_SPc 281..515 CDD:214473 66/245 (27%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 68/252 (27%)
Tryp_SPc 30..259 CDD:238113 69/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.