DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG12951

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:257 Identity:69/257 - (26%)
Similarity:103/257 - (40%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 IPRIASPTNEEAVLHEFPPMAGVLTKKHGKVFCGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVV 336
            |.|:.:.|:...:.:   |....|....|...||.:||...::::||||..|   ..|..|.:..
  Fly    27 ISRVVNGTDSSVLKY---PFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNG---RPADTLSIQF 85

  Fly   337 GEHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVW-SQHVGPACLP---- 396
            |    .::..........:..:|.|||| ..:.|..|||::|.......: ...|.|..||    
  Fly    86 G----VTNISAMGPNVVGIKKIIQHEDF-DPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAF 145

  Fly   397 LQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGL--PPHTF 459
            ..|..|      ||.:.|..|||.....|.....|.:.:|.:.....|   .|...|.  |.:..
  Fly   146 AVPQSD------AGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEEC---TSRHNGQTDPKYHI 201

  Fly   460 C--TYTPGRDTCQYDSGGALYERINGRLMAVGIVSFG-QAC-AAQQPSVNTRVASFIKWIRT 517
            |  ....|:..|..||||.|.  .||:  .|||||:. :.| .|..|.|..:|:.::.||::
  Fly   202 CGGVDEGGKGQCSGDSGGPLI--YNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 65/245 (27%)
Tryp_SPc 281..515 CDD:214473 64/244 (26%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 66/251 (26%)
Tryp_SPc 30..260 CDD:238113 67/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.