DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG9372

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:258 Identity:78/258 - (30%)
Similarity:130/258 - (50%) Gaps:20/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 QPTCSCGWSRIPRIASPTNEEAVLHEFPPMAGVLTKKHGKVFCGAAIIHHRYLLSAAHCFLGPET 326
            |..|.....:.||:..  ...|...|:|.||.:|.:....|:||..:|..|::|:||||..   .
  Fly   161 QRGCGITSRQFPRLTG--GRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIY---K 220

  Fly   327 NSAAKLRVVVGEHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVG 391
            .:...:.|.:||::.....||.| :.:.:..::||.|::..:..  ||||:::...|.:::.::.
  Fly   221 KNKEDIFVRLGEYNTHMLNETRA-RDFRIANMVLHIDYNPQNYD--NDIAIVRIDRATIFNTYIW 282

  Fly   392 PACLPLQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGLPP 456
            |.|:| ...||     .:....:..||||..:|||.::.|::..|.|.....||.  |....:|.
  Fly   283 PVCMP-PVNED-----WSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRS--SFVQHVPD 339

  Fly   457 HTFCTYTP--GRDTCQYDSGGALYERI-NGRLMAVGIVSFGQACAAQ-QPSVNTRVASFIKWI 515
            ...|...|  |:|:||.||||.|..:: |.|.:.:||||:|..|..: :|.:.|||..::.||
  Fly   340 TAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 74/239 (31%)
Tryp_SPc 281..515 CDD:214473 72/237 (30%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 73/244 (30%)
Tryp_SPc 176..402 CDD:238113 72/241 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.