DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG3700

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:261 Identity:84/261 - (32%)
Similarity:121/261 - (46%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EFPPMAGVLTKKHGKV------FCGAAIIHHRYLLSAAHCF---------LGPETNSAAKLRVVV 336
            |||.||.:.|.:..|.      .||.:::|.:::|:||||.         |.|..:| .|..|.:
  Fly   112 EFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDS-PKFVVRL 175

  Fly   337 GEHDLASSFETFATQRYDLDALILH-----EDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLP 396
            ||.|..|:.:....|.:.:...::|     ||..|..   |||||:::......::.||...|||
  Fly   176 GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGF---KNDIALVELDRKAEFNDHVAAVCLP 237

  Fly   397 LQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGLPPHT-FC 460
            ...|.|.|       ||.|||||.|:.|...:| |||..|.......|::.|..:  :...| ||
  Fly   238 PDSGNDVQ-------QVTAAGWGFTADGVKSSH-LLKVNLQRFSDEVCQKRLRFS--IDTRTQFC 292

  Fly   461 --TYTPGRDTCQYDSGG------ALYERINGRLMAVGIVSFGQACAAQ-QPSVNTRVASFIKWIR 516
              :.:...|||..||||      .||..:.   ..:||||:|..|.:| .|||.|:|..:..||.
  Fly   293 AGSMSSQADTCNGDSGGPIFVQHPLYPCLK---QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354

  Fly   517 T 517
            :
  Fly   355 S 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 83/258 (32%)
Tryp_SPc 281..515 CDD:214473 82/257 (32%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/261 (32%)
Tryp_SPc 102..353 CDD:214473 82/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.