DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG4259

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:265 Identity:68/265 - (25%)
Similarity:108/265 - (40%) Gaps:49/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 WSRIPRIASPTNEEAVLHEFPPMAGVLTKKHGKV-FCG-AAIIHHRYLLSAAHCFLGPETNSAAK 331
            :::|.|....:|..|.   ||.:..||.::.... :.| .::|:...:|:|||..     |...|
  Fly    23 YNQIRRETYGSNPRAT---FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHIL-----NGTTK 79

  Fly   332 LRVVV--GEHDLASSFETFATQRYDLDAL--ILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGP 392
            ..:||  ||.|.::   |...|..||:.|  :.||.|::.:.:  |::|:|....|...:.::..
  Fly    80 YDLVVRAGEWDTST---TADQQHVDLEVLNIVSHEQFNRFNAE--NNMALLILVSAFEMTANINL 139

  Fly   393 ACLPLQPGEDGQKLPLAGHQVVAA---GWGTTSYGGPQTHRLLKAT-LDVIDGRRCRQALSSAGG 453
            ..|.||.         ||.|..:.   |||...........:||.. :|::....|     |:..
  Fly   140 IPLYLQE---------AGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC-----SSRK 190

  Fly   454 LPPHTFCTYTPGRDTCQYDSGGALYERI---NGRLMAVGIVSFGQACAAQQPSVN-----TRVAS 510
            ||....|........|..|.|..|..||   ..:...||||::    .:|:|..|     |.||.
  Fly   191 LPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNW----LSQKPVENTFIVFTNVAG 251

  Fly   511 FIKWI 515
            .:.||
  Fly   252 LLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 65/253 (26%)
Tryp_SPc 281..515 CDD:214473 63/251 (25%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/246 (26%)
Tryp_SPc 39..256 CDD:214473 62/244 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.