DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and Ser7

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:330 Identity:94/330 - (28%)
Similarity:136/330 - (41%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 SSSKTSAKRARIVSSYPTAAPSPGHGGGRFSCLVEAFQPTCSCGWSRIPRIASPTNEEAVLHEFP 289
            :||.|:.|      ..|...|.|..|   ...|.|  .|.|...:|.  |:....|  ..|.|||
  Fly    95 TSSTTTLK------LLPRTTPRPPSG---IDQLPE--HPYCGSAFSF--RLVGGHN--TGLFEFP 144

  Fly   290 --PMAGVLTKKHGKVF-CGAAIIHHRYLLSAAHCF--LGPETNSAAKLRVVVG----------EH 339
              .:....|...||.: |||:.|..|:||:||||.  :|....:|     ::|          |:
  Fly   145 WTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAA-----ILGEWNRDTDPDCEN 204

  Fly   340 DLASSFETFATQ-RYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVW--SQHVGPACLPLQPGE 401
            ||....|..... |..:|.::.|..:|:.:  .:||||:|:....:.|  .|::.|.|||.|.|.
  Fly   205 DLNGVRECAPPHIRVTIDRILPHAQYSELN--YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGR 267

  Fly   402 DGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQAL------------SSAGGL 454
            ...:  |||.....:|||.|...|....: .||.|.:....:|::|.            ..||| 
  Fly   268 YANQ--LAGSAADVSGWGKTESSGSSKIK-QKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGG- 328

  Fly   455 PPHTFCTYTPGRDTCQYDSGGALYERINGR-----LMAVGIVSFGQA-C-AAQQPSVNTRVASFI 512
                    ..|.|:|..||||.|....|..     :...|:||.|:. | .|....:.|||:|::
  Fly   329 --------EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYM 385

  Fly   513 KWIRT 517
            .||.:
  Fly   386 DWIES 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 78/271 (29%)
Tryp_SPc 281..515 CDD:214473 77/270 (29%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/277 (29%)
Tryp_SPc 133..391 CDD:238113 80/279 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.