DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and Corin

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_872279.2 Gene:Corin / 289596 RGDID:727887 Length:1111 Species:Rattus norvegicus


Alignment Length:238 Identity:62/238 - (26%)
Similarity:102/238 - (42%) Gaps:30/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 FPPMAGVLTKKHGKVFCGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHDLASSFETFATQR 352
            :|....:.::..|.: ||..:|..:::|:.||||.|.|.....|:...:...|..|.|    .|.
  Rat   878 WPWQCSLQSEPSGHI-CGCVLIAKKWVLTVAHCFEGREDADVWKVVFGINNLDHPSGF----MQT 937

  Fly   353 YDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLP-----LQPGEDGQKLPLAGHQ 412
            ..:..::||..:|:|  ....||::::....|..:.:|.|.|||     |:|..          .
  Rat   938 RFVKTILLHPRYSRA--VVDYDISVVELSDDINETSYVRPVCLPSPREFLEPDT----------Y 990

  Fly   413 VVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGLPPHTFCT-YTPGR-DTCQYDSGG 475
            ....|||  ..|.....:|.:..:.:|...:| |:......:.....|. |..|. |:|..||||
  Rat   991 CYITGWG--HMGNKMPFKLQEGEVRIIPLEQC-QSYFDMKTITNRMICAGYESGTVDSCMGDSGG 1052

  Fly   476 ALY-ERINGRLMAVGIVSFGQACAAQ--QPSVNTRVASFIKWI 515
            .|. ||..|:....|:.|:|..|.::  .|.|.:.|:.|:.||
  Rat  1053 PLVCERPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVDWI 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 62/238 (26%)
Tryp_SPc 281..515 CDD:214473 60/236 (25%)
CorinNP_872279.2 DDNN motif 93..96
CRD_corin_1 200..329 CDD:143554
LDLa 335..370 CDD:238060
LDLa 372..406 CDD:238060
Ldl_recept_a 413..443 CDD:395011
LDLa 453..480 CDD:238060
CRD_corin_2 521..641 CDD:143579
Ldl_recept_a 646..680 CDD:395011
LDLa <693..718 CDD:238060
LDLa 721..755 CDD:238060
SRCR_2 779..859 CDD:413346
Tryp_SPc 867..1098 CDD:238113 62/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.