DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and F9

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:256 Identity:67/256 - (26%)
Similarity:123/256 - (48%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 TNEEAVLHEFPPMAGVLTKKHGKV------------FCGAAIIHHRYLLSAAHCFLGPETNSAAK 331
            |.....:::|..:.|....|.|::            |||.|||:.:::::|||| |.|    ..|
  Rat   216 TENSEPINDFTRVVGGENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTAAHC-LKP----GDK 275

  Fly   332 LRVVVGEHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLP 396
            :.||.|||::....:|  .||.::...|.|..::....:..:|||:|:....::.:.:|.|.|: 
  Rat   276 IEVVAGEHNIDEKEDT--EQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICV- 337

  Fly   397 LQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGLPPHTFCT 461
              ..::...:.|.......:|||.....|.|...|....:.::|...|.:  |:...:..:.||.
  Rat   338 --ANKEYTNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLR--STKFSIYNNMFCA 398

  Fly   462 -YTP-GRDTCQYDSGGALYERINGRLMAVGIVSFGQACAAQ-QPSVNTRVASFIKWIRTKS 519
             |.. |:|:|:.||||.....:.|.....||:|:|:.||.: :..:.|:|:.::.||:.|:
  Rat   399 GYREGGKDSCEGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKT 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 64/249 (26%)
Tryp_SPc 281..515 CDD:214473 63/248 (25%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 227..455 CDD:214473 62/239 (26%)
Tryp_SPc 228..458 CDD:238113 64/241 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.