DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG30002

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:288 Identity:84/288 - (29%)
Similarity:124/288 - (43%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 GGRFSCLVEAFQPTCSCGWSRIPRIASPTNEEAVLHEFPPMAGVLTKKHGKVFCGAAIIHHRYLL 315
            |||.|.|:.  ||     |.....|||...                    ...||.::|...::|
  Fly    64 GGRKSSLMS--QP-----WMAFLHIASDLE--------------------MCRCGGSLISELFVL 101

  Fly   316 SAAHCF-LGPETNSAAKLRVVVGEHDLASSFE--TFATQR--------YDLDALILHEDFSQASG 369
            :||||| :.|.:.   ::||.:||.||:|:.:  |:..:|        :.:|..||||:|:..  
  Fly   102 TAAHCFKMCPRSK---EIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLF-- 161

  Fly   370 QPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKA 434
            .|..|||::|....:|:..|:.|.||||........|.| |.:.:|.|||.|     ::.|...:
  Fly   162 YPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQL-GQRFMAVGWGKT-----ESLRYANS 220

  Fly   435 TLDV-IDGRRCRQALSSAGGLPPHTFCTYTPGRDTCQYDSGGALYERI----NGRLMAVGIVSFG 494
            |::| |...:|      ..|......|......|||..||||.|..:.    ..|.:..|:||.|
  Fly   221 TMEVDIRTEKC------TDGRDTSFLCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTG 279

  Fly   495 -QACAAQQPSVNTRVASFIKWIRTKSPE 521
             |.|.|...:....|.:::.||..|..|
  Fly   280 SQNCGAGHKAYYMDVPTYMPWILEKMAE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 70/251 (28%)
Tryp_SPc 281..515 CDD:214473 69/250 (28%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 80/280 (29%)
Tryp_SPc 62..301 CDD:238113 80/280 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.