DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and C1s

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_620255.2 Gene:C1s / 192262 RGDID:619983 Length:694 Species:Rattus norvegicus


Alignment Length:570 Identity:118/570 - (20%)
Similarity:192/570 - (33%) Gaps:172/570 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 INSPYYPALYPVGTSCRYAVEAPKDHVLQFKCELQLRTLSTDLKCRTEVFHFNSEGD--EVLT-- 97
            |.||.||..||..:.|.|.:...:.    |:..|.:|....|::      ..:|||:  :.||  
  Rat   193 IASPNYPNPYPENSRCEYQIRLQEG----FRLVLTIRREDFDVE------PADSEGNCHDSLTFA 247

  Fly    98 --SSEY--FCGSGKFERKSFLNRAVISYISSGHSEPPSAVKLKDKLHAVPTTSTTTEAPQAVSIE 158
              :.::  :||:|.                      |..:.:|       |.|.|.:......:.
  Rat   248 AKNQQFGPYCGNGF----------------------PGPLTIK-------TQSNTLDIVFQTDLT 283

  Fly   159 EQDAEEEQEEEEEPEEADEDLS-------DEVLHVLQDV-------GVSDALAYVASLLYDVEES 209
            .|:...:.....:|....:::|       ::..:|.:||       |            ::|.|.
  Rat   284 GQNKGWKLRYHGDPIPCPKEISANSIWEPEKAKYVFKDVVKITCVDG------------FEVVEG 336

  Fly   210 RKSSTTIY-------------LDKLPIRSSSKTSAKRARIVSSYPTAAPSPGH------------ 249
            ...||:.|             |:..|:........:..::.....|...|..|            
  Rat   337 NVGSTSFYSTCQSNGQWSNSRLECQPVDCGVPEPIENGKVEDPEDTVFGSVIHYTCEEPYYYMEQ 401

  Fly   250 -GGGRFSCL-----------VEAFQPTCSCGWSRIPRIASPTNEEAVLHEFPPMAGVLTKKHG-- 300
             .||.:.|.           ||.  |.|      ||....||....|....  ..|..||...  
  Rat   402 EEGGEYHCAANGSWVNDQLGVEL--PKC------IPVCGVPTEPFKVQQRI--FGGYSTKIQSFP 456

  Fly   301 -KVFC-----GAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHD--------LASSFETFATQ 351
             :|:.     |.|:|...::|:|||              ||.|..|        |.........|
  Rat   457 WQVYFESPRGGGALIDEYWVLTAAH--------------VVEGNSDPVMYVGSTLLKIERLRNAQ 507

  Fly   352 RYDLDALILH-----EDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPLAGH 411
            |...:.:|:|     ||.........||||:::.:..:.....|.|.||| :...|..  |..|.
  Rat   508 RLITERVIIHPSWKQEDDLNTRTNFDNDIALVQLKDPVKMGPTVAPICLP-ETSSDYN--PSEGD 569

  Fly   412 QVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQ-------ALSSAGGLPPHTFCTYTPGRDTC 469
            ..:.:|||.|. ......:|..|.|.:....:|:|       |.|:......:..|....|.|:|
  Rat   570 LGLISGWGRTE-NRTNVIQLRGAKLPITSLEKCQQVKVENPKARSNDYVFTDNMICAGEKGVDSC 633

  Fly   470 QYDSGGALYERI----NGRLMAVGIVSFGQACAAQQPSVNTRVASFIKWI 515
            :.|||||....:    :.:....|:||:|:.|...  .:.|:|.:::.||
  Rat   634 EGDSGGAFALPVPNVKDPKFYVAGLVSWGKKCGTY--GIYTKVKNYVDWI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042 21/96 (22%)
Tryp_SPc 281..516 CDD:238113 64/267 (24%)
Tryp_SPc 281..515 CDD:214473 62/265 (23%)
C1sNP_620255.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:405372
CUB 181..293 CDD:395345 27/138 (20%)
CCP 300..361 CDD:153056 11/72 (15%)
CCP 365..428 CDD:153056 10/70 (14%)
Tryp_SPc 443..681 CDD:214473 61/259 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.