DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and MASP2

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:578 Identity:134/578 - (23%)
Similarity:216/578 - (37%) Gaps:167/578 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CNHQVKLQ-SGQKLLINSPYYPALYPVGTSCRYAVEAPK------DHVLQFKCELQLRTLSTDLK 80
            |:.||..| ||:   ::||.||..||..:||.|::...:      |.|..|..|....||     
Human   184 CSGQVFTQRSGE---LSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETL----- 240

  Fly    81 CRTEVFHFNSEGDEVLTSSEYFCGS---GKFERKSFLNRAVISYIS------------------- 123
            |..:.....::.:|    ...|||.   .:.|.||  |...|::::                   
Human   241 CPYDFLKIQTDREE----HGPFCGKTLPHRIETKS--NTVTITFVTDESGDHTGWKIHYTSTAQP 299

  Fly   124 --------SGHSEPPSA-VKLKDKLHA------------VPTTSTTTEAPQAVSIEEQDAEEEQE 167
                    :||..|..| ..|||....            :|..|.|       ::.::|...:: 
Human   300 CPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFT-------AVCQKDGSWDR- 356

  Fly   168 EEEEPEEA--------DEDLSDEVLHVLQDVGVSDALAYVASLLYDVEESRKSSTTIYLDKLPIR 224
                |..|        .:||....:..:...||:   .|.|.:.|..||      |.|..|:   
Human   357 ----PMPACSIVDCGPPDDLPSGRVEYITGPGVT---TYKAVIQYSCEE------TFYTMKV--- 405

  Fly   225 SSSKTSAKRARIVSSYPTAAPSPGHGGGRFSCLVEAF---------QPTCS--CGWSRIPRIASP 278
                                     ..|::.|..:.|         .|.|.  ||.|     |..
Human   406 -------------------------NDGKYVCEADGFWTSSKGEKSLPVCEPVCGLS-----ART 440

  Fly   279 T------NEEAVLHEFPPMAGVLTKKHGKVFCGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVG 337
            |      .::|...:||....:|    |......|:::..::|:|||. :..:.:.|:.|.:.:|
Human   441 TGGRIYGGQKAKPGDFPWQVLIL----GGTTAAGALLYDNWVLTAAHA-VYEQKHDASALDIRMG 500

  Fly   338 EHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGED 402
            .....|...|.|..    :|:.:||.::..:|. .||||::|....:|.:.::.|.|||.:..|.
Human   501 TLKRLSPHYTQAWS----EAVFIHEGYTHDAGF-DNDIALIKLNNKVVINSNITPICLPRKEAES 560

  Fly   403 GQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSS----AGGLPPHTFCT-- 461
            ..:....|   .|:|||.|..|. ....|:...:.::|.::|..|...    .|.:..:..|.  
Human   561 FMRTDDIG---TASGWGLTQRGF-LARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGL 621

  Fly   462 YTPGRDTCQYDSGGAL--YERINGRLMAVGIVSFGQA-CA-AQQPSVNTRVASFIKWI 515
            .:.|:|:|:.||||||  .:....|....||||:|.. |. |.|..|.|:|.::|.||
Human   622 ESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWI 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042 25/124 (20%)
Tryp_SPc 281..516 CDD:238113 68/245 (28%)
Tryp_SPc 281..515 CDD:214473 66/243 (27%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839 31/122 (25%)
CCP 300..361 CDD:214478 12/72 (17%)
Sushi 366..430 CDD:278512 16/100 (16%)
Tryp_SPc 444..679 CDD:214473 66/248 (27%)
Tryp_SPc 445..682 CDD:238113 68/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.