DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnut and Septin12

DIOPT Version :9

Sequence 1:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_006522640.1 Gene:Septin12 / 71089 MGIID:1918339 Length:362 Species:Mus musculus


Alignment Length:316 Identity:137/316 - (43%)
Similarity:208/316 - (65%) Gaps:12/316 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSD 166
            :.:|..|..|    |.|:.|.||...:.:|:..||:|.||||.:||||.|||||||::|::|.|.
Mouse    11 SSRPSSPRTP----PNEMFGPVGIEAVLDQLRIKAMKTGFEFNIMVVGQSGLGKSTMVNTLFKSK 71

  Fly   167 IYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKY 231
            ::.:.: |...:...:|:.:.:...:::|.|:.|.|||.|||||||.::|..||.|||.|::.:|
Mouse    72 VWQSTE-PNLDVPMPQTLELHSVTHVIEEKGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQY 135

  Fly   232 EEYLTAESRVYR-KTISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPD 295
            |:||..|..:.| :.|.|:|||||:||:.|:||.|.||||..::.|...||:|||||:||::|.:
Mouse   136 EQYLQEELLITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLRRLCRTVNVVPVIARADSLTIE 200

  Fly   296 EVHLFKKQILNEIAQHKIKIYDFPATLEDAAEEAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGR 360
            |...|:.:|...:..|.|.:|......||..:....:: :|.::|||||||:.....:|:.|.||
Mouse   201 ERDAFRSRIQQNLKTHCIDVYPQKCFDEDVNDRLLNSK-IREQIPFAVVGADREHIVNGRCVLGR 264

  Fly   361 RYPWGLVE-----VENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSE 411
            :..||::|     |||:.||:|:.||:::||:|||||||:|:||||||||..:|:|
Mouse   265 KTKWGIIEGPCLAVENMAHCEFLLLRDLLIRSHLQDLKDITHNVHYENYRVLRLNE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnutNP_477064.1 CDC3 121..482 CDD:227352 132/297 (44%)
Septin 139..411 CDD:279124 124/277 (45%)
Septin12XP_006522640.1 CDC_Septin 45..320 CDD:206649 124/276 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.