DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnut and SEPTIN2

DIOPT Version :9

Sequence 1:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_024308688.1 Gene:SEPTIN2 / 4735 HGNCID:7729 Length:428 Species:Homo sapiens


Alignment Length:376 Identity:183/376 - (48%)
Similarity:257/376 - (68%) Gaps:14/376 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LDTSGGGASNGDSNKLTHDLQEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKR 139
            |:..|...|.|..::.:..:.:::..|...|:.|            ||||||||||||:||:||:
Human    49 LEEWGHQNSFGSRDEASQKMSKQQPTQFINPETP------------GYVGFANLPNQVHRKSVKK 101

  Fly   140 GFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTV 204
            ||||||||||.|||||||||||:||:|:|.....||.:.:.::||.:||:.|.::|.||.|.|||
Human   102 GFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTV 166

  Fly   205 VDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLD 269
            |||||:|||::..:|:..|:.|:|.::|.||..||.:.|:.|.|:|||||.|||:|.||||.|||
Human   167 VDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLD 231

  Fly   270 IACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAAEEAK-TTQ 333
            :|.|:::.:|||:|||||||||:|..|....||:||:||.:|.||||..|....|..|:.| .|:
Human   232 VAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTR 296

  Fly   334 NLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNN 398
            .|::.:||:|||:|.:||..|||||||.||||:|||||..|.||:.||.|:| ||:|||::||.:
Human   297 LLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQD 360

  Fly   399 VHYENYRCRKLSELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEME 449
            :||||:|..:|...|.......::....|.:.|.|.|..::.:.:|:|:|:
Human   361 LHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnutNP_477064.1 CDC3 121..482 CDD:227352 176/330 (53%)
Septin 139..411 CDD:279124 152/272 (56%)
SEPTIN2XP_024308688.1 Septin 102..373 CDD:307057 152/271 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51878
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 1 1.000 - - X204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.