DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnut and Septin4

DIOPT Version :9

Sequence 1:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_006532556.1 Gene:Septin4 / 18952 MGIID:1270156 Length:971 Species:Mus musculus


Alignment Length:461 Identity:199/461 - (43%)
Similarity:265/461 - (57%) Gaps:81/461 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAISALPSTLAQLALRDKQQAASASASSATNGSSGSESLVGVGGRPPNQPPSVPVAASGKLDTSG 79
            |::...||        |.||..||.|                    |..|.|.|.:..||||   
Mouse   573 GSLWPQPS--------DSQQYFSAPA--------------------PLSPSSRPRSPWGKLD--- 606

  Fly    80 GGASNGDSNKLTHDLQEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFT 144
                       .:|..|.:.:                     |||||.|||||:||:||:||:||
Mouse   607 -----------PYDSSEDDKE---------------------YVGFATLPNQVHRKSVKKGFDFT 639

  Fly   145 LMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPG 209
            |||.|.||||||||:||:||:|:|...:..|...|..:||.:....|.::|.||.|.||:|||||
Mouse   640 LMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPG 704

  Fly   210 FGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACMQ 274
            |||||:|:.||.|:.||:|.::|:|...||.:.||.|.|:|||||||||:|.||||.|||:..|:
Mouse   705 FGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMK 769

  Fly   275 SLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAAEEAK-TTQNLRSR 338
            :|..:||:||::|||||:||.||...|.:|..||....||||.||....|..|:.| ..|.|:..
Mouse   770 ALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKES 834

  Fly   339 VPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYEN 403
            :||||:|:||::|..|::||||.||||:|||||..||||:.||.|::|||:|||||||...||||
Mouse   835 IPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYEN 899

  Fly   404 YRCRKLSELGLVDGKARLSNK--------------NPLTQMEEEK--REHEQKMKKMEAEMEQVF 452
            ||.:.:..:..:..|.|..||              .|.|..|.||  ||.::::::|: ||....
Mouse   900 YRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQ-EMLHKI 963

  Fly   453 DMKVKE 458
            ..::||
Mouse   964 QRQMKE 969

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnutNP_477064.1 CDC3 121..482 CDD:227352 180/355 (51%)
Septin 139..411 CDD:279124 150/272 (55%)
Septin4XP_006532556.1 DUF4655 14..509 CDD:373934
Septin 634..914 CDD:366275 150/279 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51878
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 1 1.000 - - X204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.