DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnut and Septin2

DIOPT Version :9

Sequence 1:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_038938891.1 Gene:Septin2 / 117515 RGDID:620056 Length:387 Species:Rattus norvegicus


Alignment Length:372 Identity:183/372 - (49%)
Similarity:256/372 - (68%) Gaps:18/372 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GGGASNGDSNKLTHDLQEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEF 143
            ||.:....|.|::    :::..|...|:.|            ||||||||||||:||:||:||||
  Rat    16 GGWSWTEKSRKMS----KQQPTQFINPETP------------GYVGFANLPNQVHRKSVKKGFEF 64

  Fly   144 TLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTP 208
            ||||||.|||||||||||:||:|:|.....||.:.:.::||.:||:.|.::|.||.|.|||||||
  Rat    65 TLMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTP 129

  Fly   209 GFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACM 273
            |:|||:::.:|:..|:.|:|.::|.||..||.:.|:.|.|:|||||.|||:|.||||.|||:|.|
  Rat   130 GYGDAINSRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFM 194

  Fly   274 QSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAAEEAK-TTQNLRS 337
            :::.:|||:|||||||||:|..|....||:||:||.:|.||||..|....|..|:.| .|:.|::
  Rat   195 KAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDEDFKEQTRLLKA 259

  Fly   338 RVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYE 402
            .:||:|||:|.:||..|||||||.||||:|||||..|.||:.||.|:| ||:|||::||.::|||
  Rat   260 SIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYE 323

  Fly   403 NYRCRKLSELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEME 449
            |:|..:|...|.......::....|.:.|.|.|..::.:.:|:|:|:
  Rat   324 NFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnutNP_477064.1 CDC3 121..482 CDD:227352 176/330 (53%)
Septin 139..411 CDD:279124 152/272 (56%)
Septin2XP_038938891.1 Septin 61..332 CDD:395596 152/271 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51878
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X204
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.