DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnut and Septin5

DIOPT Version :9

Sequence 1:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_446383.4 Gene:Septin5 / 116728 RGDID:621763 Length:378 Species:Rattus norvegicus


Alignment Length:344 Identity:170/344 - (49%)
Similarity:239/344 - (69%) Gaps:4/344 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 YVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAV 186
            |||||.|||||:||:||:||:|||||.|.||||||||::|:||:|:|...:......|..:||.:
  Rat    33 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVEI 97

  Fly   187 EATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRV 251
            ....|.::|.||.|.||:||||||||||:|..||.||.:|||.::|:|...||.:.||.|.|:||
  Rat    98 LKHTVDIEEKGVKLKLTIVDTPGFGDAVNNFECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRV 162

  Fly   252 HCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIY 316
            |||||||:|.||||.|:|:..|::|.:|||:||:|||||.:.|.|:...|.:|..||.:..|.:|
  Rat   163 HCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVY 227

  Fly   317 DFPATLEDAAEEAK-TTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIAL 380
            .||....|..|:.| ..:.|:...||||:|:||::|..|::||||.||||:|||||..||||:.|
  Rat   228 QFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKL 292

  Fly   381 RNMVIRTHLQDLKDVTNNVHYENYRCRKLSEL-GLVDGKARLSNKNPLTQMEEEKREHEQKMKKM 444
            |||:||||:.||||||.:|||||||...:.:: ..:...:|:.:..|:..:.....|.|:.::..
  Rat   293 RNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDSETEKLIRMK 357

  Fly   445 EAEMEQVFDM--KVKEKMQ 461
            :.|:.::.:|  |:|::||
  Rat   358 DEELRRMQEMLQKMKQQMQ 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnutNP_477064.1 CDC3 121..482 CDD:227352 170/344 (49%)
Septin 139..411 CDD:279124 146/272 (54%)
Septin5NP_446383.4 CDC3 32..360 CDD:227352 164/326 (50%)
Septin 50..322 CDD:279124 146/271 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51878
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X204
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.