DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnut and LOC102550225

DIOPT Version :9

Sequence 1:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_038954020.1 Gene:LOC102550225 / 102550225 RGDID:7746684 Length:384 Species:Rattus norvegicus


Alignment Length:399 Identity:246/399 - (61%)
Similarity:302/399 - (75%) Gaps:20/399 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 MVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGF 210
            ||||.|||.|||||||:||:|:|:.| |||||.|.||||.||.:||::||.||...||:|||||.
  Rat     1 MVVGESGLEKSTLINSLFLTDLYSLE-YPGPSRRIKKTVQVEQSKVLVKEGGVQSLLTIVDTPGL 64

  Fly   211 GDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACMQS 275
            |.||||||||.|:::|:|||:|:||.|||||.|:.:.|:||.|||||||||||||..|||..|:.
  Rat    65 GGAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKSLDIEFMKR 129

  Fly   276 LSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAAEEAKTTQNLRSRVP 340
            |.:|||::|:||||||:||:|...|||||:.||.:||||||:||.|  |..||.|..:.::.|:|
  Rat   130 LHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPET--DDEEENKLVKKIKDRLP 192

  Fly   341 FAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYR 405
            .||||:|||||.:||:||||:||||:.||||..||||..||||:||||:||||||||||||||||
  Rat   193 LAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYR 257

  Fly   406 CRKLSELGL--VD---GKARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRD 465
            .|||:.:..  ||   .|.:|: |:||.|||||:|||..||||||.||||||:||||||:|||:|
  Rat   258 SRKLAAVTYNGVDNNKNKGQLT-KSPLVQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKD 321

  Fly   466 SELELARRHEERKKALELQIRELEEKRREFEREKKEWEDVNHVTLEELKRRSLGANSSTDNVDGK 530
            ||.||.||||:.|..||.|.:|||||||:||.||..||....:..::...|:|           :
  Rat   322 SEAELQRRHEQMKMNLEAQHKELEEKRRQFEEEKANWEAQQRILEQQNSSRTL-----------E 375

  Fly   531 KEKKKKGLF 539
            |.|||..:|
  Rat   376 KNKKKGKIF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnutNP_477064.1 CDC3 121..482 CDD:227352 223/340 (66%)
Septin 139..411 CDD:279124 177/264 (67%)
LOC102550225XP_038954020.1 CDC_Septin 1..264 CDD:206649 177/265 (67%)
DUF4670 <275..380 CDD:406200 64/116 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.