DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and BHLHE40

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_003661.1 Gene:BHLHE40 / 8553 HGNCID:1046 Length:412 Species:Homo sapiens


Alignment Length:412 Identity:91/412 - (22%)
Similarity:143/412 - (34%) Gaps:174/412 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GLSKAE-LRKTNK---PIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHL 94
            |:.::| .::|.|   .::||:||.|||.|:.:||.|:.|.:|.....|  ||||.:||:|:||:
Human    42 GIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGH--LEKAVVLELTLKHV 104

  Fly    95 QSV-----QRQQLNMAIQSD-----------PSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQ 143
            :::     |:||..:|:||.           .:..:.|.:||..||.||.:|:::.:........
Human   105 KALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSS 169

  Fly   144 RLSAHLNQCANSL--------------------------------------------------EQ 158
            :|..||::..:.|                                                  ||
Human   170 QLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQ 234

  Fly   159 IGSMSNFSNGY-----RGGLFPATAVTAAPTPLFPSLPQDLNNNSR-----------TESSAPAI 207
            .||.::..:||     :|.|       .:..|.|.|     ::..|           .||..|..
Human   235 SGSDTDTDSGYGGESEKGDL-------RSEQPCFKS-----DHGRRFTMGERIGAIKQESEEPPT 287

  Fly   208 QMGGLQLI------------------------PSRLPSGEFALIMPNTGSAAP-------PPG-P 240
            :...:||.                        |..||   |.||.|:..:..|       |.. |
Human   288 KKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLP---FYLIPPSATAYLPMLEKCWYPTSVP 349

  Fly   241 FAWPGSAAGVAAGTASAALASIANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTLPG--- 302
            ..:||..|..||                        :|:|..|...|.|..:|:.|...||.   
Human   350 VLYPGLNASAAA------------------------LSSFMNPDKISAPLLMPQRLPSPLPAHPS 390

  Fly   303 -------QTQLPVKNSTSPPLS 317
                   |...|:     |||:
Human   391 VDSSVLLQALKPI-----PPLN 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 27/70 (39%)
ORANGE 114..158 CDD:128787 12/93 (13%)
BHLHE40NP_003661.1 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer 1..139 33/98 (34%)
bHLH-O_DEC1 40..129 CDD:381592 33/88 (38%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000269|PubMed:19786558 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..303 18/132 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.