DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hes7

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:236 Identity:66/236 - (27%)
Similarity:94/236 - (39%) Gaps:58/236 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KAELR---KTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQ 98
            :||.|   |..||::|||||.|||..|.||:.|:||..:....|:.|||||:|||..|.:|:...
Mouse     6 RAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERS 70

  Fly    99 RQQLNMAIQSDP-----SVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQ 158
            |.: ...:...|     ::...:.:||.||.                  .||:|..:..:.:.. 
Mouse    71 RVE-PPGVPRSPGQDAEALASCYLSGFRECL------------------LRLAAFAHDASPAAR- 115

  Fly   159 IGSMSNFSNGYRGGLFPATAVT----AAPTP--------LFPSLPQDLNNNSRTESSAPAIQMG- 210
             ..:.:..:|||....|.....    .||.|        |.|:|.|           .|.:..| 
Mouse   116 -SQLFSALHGYRRPKPPRPEAVDPGLPAPRPPLDPASPILGPALHQ-----------RPPVHQGP 168

  Fly   211 ---GLQLIPSRLPS--GEFALIMPNTGSAAPPPGPFAWPGS 246
               .|...||...|  |:.....|.||...|||.|:...|:
Mouse   169 PSPRLAWSPSHCSSRAGDSGAPAPLTGLLPPPPPPYRQDGA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 31/64 (48%)
ORANGE 114..158 CDD:128787 7/43 (16%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 29/58 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 26/97 (27%)
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.