DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and AT3G56770

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_191236.1 Gene:AT3G56770 / 824844 AraportID:AT3G56770 Length:230 Species:Arabidopsis thaliana


Alignment Length:107 Identity:28/107 - (26%)
Similarity:50/107 - (46%) Gaps:30/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQL 102
            |.||  |....|::||||||..||:|:.|:        :.::|.:|:.:|...|:.::.:::|.|
plant    44 ASLR--NHKEAERKRRARINSHLNKLRKLL--------SCNSKTDKSTLLAKVVQRVKELKQQTL 98

  Fly   103 NMAIQSDPSVVQK------------------FKTGFVECAEE 126
            .:..::.||...:                  ||..|  |.|:
plant    99 EITDETIPSETDEISVLNIEDCSRGDDRRIIFKVSF--CCED 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 18/61 (30%)
ORANGE 114..158 CDD:128787 5/31 (16%)
AT3G56770NP_191236.1 HLH 47..96 CDD:238036 17/58 (29%)
ACT_UUR-ACR-like 132..198 CDD:153145 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.