DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hes5

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:200 Identity:53/200 - (26%)
Similarity:85/200 - (42%) Gaps:60/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARH---TKLEKADILEMTVKHLQS 96
            ||..|..:..||::||.||.|||..:.:|| |:||   ::.|||   :||||||||||.|.:|:.
  Rat    11 LSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLE---QEFARHQPNSKLEKADILEMAVSYLKH 71

  Fly    97 VQRQQLN---------------------------MAIQSDP-SVVQKFKTGFVECAEEVNRYVSQ 133
             .:.:|.                           .|..:.| |:.|.:..|:..|.:|..::::.
  Rat    72 -SKGELGACARVLLPTGVAPTARAPLMPLGLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTL 135

  Fly   134 MDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNS 198
            ....||  :.:|..|                    ::....||..|...|||  .:.||...:::
  Rat   136 HAASDT--QMKLLYH--------------------FQRPPAPAAPVKETPTP--GAAPQPARSST 176

  Fly   199 RTESS 203
            :..:|
  Rat   177 KAAAS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 30/64 (47%)
ORANGE 114..158 CDD:128787 8/43 (19%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 29/60 (48%)
ORANGE 116..158 CDD:128787 10/63 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.