Sequence 1: | NP_476923.1 | Gene: | dpn / 35800 | FlyBaseID: | FBgn0010109 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038966759.1 | Gene: | Hes5 / 79225 | RGDID: | 621340 | Length: | 196 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 53/200 - (26%) |
---|---|---|---|
Similarity: | 85/200 - (42%) | Gaps: | 60/200 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARH---TKLEKADILEMTVKHLQS 96
Fly 97 VQRQQLN---------------------------MAIQSDP-SVVQKFKTGFVECAEEVNRYVSQ 133
Fly 134 MDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNS 198
Fly 199 RTESS 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpn | NP_476923.1 | HLH | 39..101 | CDD:238036 | 30/64 (47%) |
ORANGE | 114..158 | CDD:128787 | 8/43 (19%) | ||
Hes5 | XP_038966759.1 | bHLH-O_HES5 | 18..74 | CDD:381467 | 29/60 (48%) |
ORANGE | 116..158 | CDD:128787 | 10/63 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334635 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |