DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and hes2.2

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001038818.1 Gene:hes2.2 / 751634 ZFINID:ZDB-GENE-060825-55 Length:172 Species:Danio rerio


Alignment Length:166 Identity:60/166 - (36%)
Similarity:81/166 - (48%) Gaps:26/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQL 102
            :|||||.||::||:||||||..|:.||:|||....||..|::||||||||||||:.|..      
Zfish     6 SELRKTLKPLLEKKRRARINDSLDRLKALILPLTGKDNCRYSKLEKADILEMTVRFLTD------ 64

  Fly   103 NMAIQSDPS--VVQKFKTGFVECAEEVNRYVSQM-----------DGIDTGVRQRLSAHLNQCAN 154
               ||:.||  ....|..|:..|.:.|:..:.|.           |.|...|..:..|..|.||.
Zfish    65 ---IQTTPSKDTAVSFTEGYTTCLQRVSARLPQTSLDAETRHRVNDFIQRSVMPKTPACQNCCAQ 126

  Fly   155 S---LEQI-GSMSNFSNGYRGGLFPATAVTAAPTPL 186
            |   :.|| ..:.|..:.......|...:.:.|.|:
Zfish   127 SSRMMSQIQQKLQNLKSSSSRSTNPKQDILSRPEPV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 37/61 (61%)
ORANGE 114..158 CDD:128787 13/57 (23%)
hes2.2NP_001038818.1 HLH 6..67 CDD:238036 38/69 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.