DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hes3

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_073178.1 Gene:Hes3 / 64628 RGDID:621339 Length:175 Species:Rattus norvegicus


Alignment Length:200 Identity:65/200 - (32%)
Similarity:87/200 - (43%) Gaps:53/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSV 112
            |||:||||||..|.:|:|| ||.......|..|||||||||::||:::|:|.....:.:.  ||.
  Rat     1 MEKKRRARINLSLEQLRSL-LERHYSHQIRKRKLEKADILELSVKYVRSLQNSLQGLWLV--PSG 62

  Fly   113 VQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLN----QCANSLE-QIGSMSNFSNGYRGG 172
            |.               |.|...|...|..|||....:    :|...|: :.||.::.:|     
  Rat    63 VD---------------YPSGFRGGLPGSSQRLRPGEDDSGLRCPLLLQRRAGSTTDSAN----- 107

  Fly   173 LFPATAVTAAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSGEF----ALIMPNTGS 233
              |.||     :.|.|.||         ...||....||     |:.|...|    .|:..:||.
  Rat   108 --PQTA-----SVLSPCLP---------AIWAPGPPAGG-----SQSPQSPFPPLGGLLESSTGI 151

  Fly   234 AAPPP 238
            .||||
  Rat   152 LAPPP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 29/52 (56%)
ORANGE 114..158 CDD:128787 9/48 (19%)
Hes3NP_073178.1 bHLH-O_HES3 1..55 CDD:381503 29/54 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..175 12/37 (32%)
WRPW motif 172..175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.