Sequence 1: | NP_476923.1 | Gene: | dpn / 35800 | FlyBaseID: | FBgn0010109 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021331987.1 | Gene: | her7 / 58132 | ZFINID: | ZDB-GENE-000427-6 | Length: | 221 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 49/199 - (24%) |
---|---|---|---|
Similarity: | 75/199 - (37%) | Gaps: | 57/199 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQR 99
Fly 100 QQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVR----QRL--------------- 145
Fly 146 ----------------------SAHLNQCANSLEQIGSMSNF----SNGYRGGLFPATAVTAAPT 184
Fly 185 PLFP 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpn | NP_476923.1 | HLH | 39..101 | CDD:238036 | 25/61 (41%) |
ORANGE | 114..158 | CDD:128787 | 13/84 (15%) | ||
her7 | XP_021331987.1 | Hairy_orange | 100..135 | CDD:311465 | 10/34 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |