DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and her7

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_021331987.1 Gene:her7 / 58132 ZFINID:ZDB-GENE-000427-6 Length:221 Species:Danio rerio


Alignment Length:199 Identity:49/199 - (24%)
Similarity:75/199 - (37%) Gaps:57/199 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQR 99
            :|.....|..||.:|:|||.|:|..|..||.|:|:..:.:.....:||||:|||.||..||...:
Zfish    23 ISPLRFLKLLKPQVERRRRERMNRSLENLKLLLLQGPEHNQPNQRRLEKAEILEYTVLFLQKANK 87

  Fly   100 QQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVR----QRL--------------- 145
                .:.:.:.....:|..||..|.::..|::.:..|::..|.    |||               
Zfish    88 ----ASKEEEGEEKSQFMEGFSSCLQKAARFLLEEGGLEGSVTSMLCQRLAHPTIRLPVRGHSRK 148

  Fly   146 ----------------------SAHLNQCANSLEQIGSMSNF----SNGYRGGLFPATAVTAAPT 184
                                  :.|.:.|.|:.|...|.:.|    ||....        ||.||
Zfish   149 QHAESNPQHHARRPHHKNTVSKAGHPSACRNTKEPQASRAAFRSTDSNTKHS--------TAQPT 205

  Fly   185 PLFP 188
            ...|
Zfish   206 SRHP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 25/61 (41%)
ORANGE 114..158 CDD:128787 13/84 (15%)
her7XP_021331987.1 Hairy_orange 100..135 CDD:311465 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.