DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and HES4

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001135939.1 Gene:HES4 / 57801 HGNCID:24149 Length:247 Species:Homo sapiens


Alignment Length:224 Identity:87/224 - (38%)
Similarity:123/224 - (54%) Gaps:44/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILE 88
            |..||.:.|     ....:::||:||||||||||..|.:||:|||:|::|:.:||:|||||||||
Human    49 GREGRGTQP-----VPDPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILE 108

  Fly    89 MTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCA 153
            |||:||:|::|.|:..|:.:||:|:.|::.||.||..||||:::..:|:...||.||..||..| 
Human   109 MTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAAC- 172

  Fly   154 NSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSR 218
              |.|:|.                  :..|..|.|:.|        .|:.||.: ..|..|:||.
Human   173 --LRQLGP------------------SRRPASLSPAAP--------AEAPAPEV-YAGRPLLPSL 208

  Fly   219 LPSGEFALIMP-------NTGSAAPPPGP 240
              .|.|.|:.|       ....|||..||
Human   209 --GGPFPLLAPPLLPGLTRALPAAPRAGP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 38/61 (62%)
ORANGE 114..158 CDD:128787 18/43 (42%)
HES4NP_001135939.1 HLH 62..119 CDD:238036 37/56 (66%)
Hairy_orange 136..174 CDD:284859 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7601
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4933
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 1 1.000 - - otm42263
orthoMCL 1 0.900 - - OOG6_105205
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3450
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.