DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and her8.2

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:205 Identity:63/205 - (30%)
Similarity:98/205 - (47%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQR 99
            :|..|.||..||::|::||.|||.||::|:..::...|.|   .:||||||||||||||||::|.
Zfish    17 ISSKEERKLRKPLIERKRRERINLCLDQLRETVVAVFKPD---QSKLEKADILEMTVKHLQNIQS 78

  Fly   100 QQLNMAIQSDP----SVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHL--------NQC 152
            .::     |||    ...|::.||:::|.:||:..:...|.:|..:..||..||        ..|
Zfish    79 SRV-----SDPVLNTGARQRYSTGYIQCMQEVHNLLHSCDWMDKTLGSRLLNHLFKSLPLSAKDC 138

  Fly   153 ANSLEQIGSMSNFSNGYRGGLFPATAVTAAPT--PLFPSLPQDLNNNSRTESSAPAI-----QMG 210
            ..                   .|.|::|:.|:  ..:.|...|...:.:..||:|.:     |..
Zfish   139 PR-------------------LPKTSLTSVPSDHSEYSSFHVDETASPKPCSSSPFLCKRPNQSQ 184

  Fly   211 GLQLIPSRLP 220
            .....|.|:|
Zfish   185 NQHFTPIRMP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 33/61 (54%)
ORANGE 114..158 CDD:128787 13/51 (25%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 32/59 (54%)
Hairy_orange 94..132 CDD:284859 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.