DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hes6

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_062352.1 Gene:Hes6 / 55927 MGIID:1859852 Length:224 Species:Mus musculus


Alignment Length:206 Identity:59/206 - (28%)
Similarity:90/206 - (43%) Gaps:34/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMA 105
            ||..||::||:||||||..|.||:.|:.....:     .|||.|::||:||:.:|...|.:....
Mouse    26 RKARKPLVEKKRRARINESLQELRLLLAGTEVQ-----AKLENAEVLELTVRRVQGALRGRARER 85

  Fly   106 IQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHL-------------NQCANSLE 157
            .|......::|..|:::|..||:.:||....||..|...|..||             :...:||.
Mouse    86 EQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHLLESMPLREGSSFQDLLGDSLA 150

  Fly   158 QIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSG 222
            .:...|..|:...|| .|.:.:::.|.| ...|..||......|          |..:|:..|. 
Mouse   151 GLPGGSGRSSWPPGG-SPESPLSSPPGP-GDDLCSDLEEIPEAE----------LNRVPAEGPD- 202

  Fly   223 EFALIMPNTGS 233
               |:..:.||
Mouse   203 ---LVSTSLGS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 26/59 (44%)
ORANGE 114..158 CDD:128787 15/56 (27%)
Hes6NP_062352.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/4 (50%)
bHLH_SF 24..81 CDD:412148 26/59 (44%)
Hairy_orange 96..134 CDD:400076 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..209 17/78 (22%)
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.