Sequence 1: | NP_476923.1 | Gene: | dpn / 35800 | FlyBaseID: | FBgn0010109 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062352.1 | Gene: | Hes6 / 55927 | MGIID: | 1859852 | Length: | 224 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 59/206 - (28%) |
---|---|---|---|
Similarity: | 90/206 - (43%) | Gaps: | 34/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 RKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMA 105
Fly 106 IQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHL-------------NQCANSLE 157
Fly 158 QIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSG 222
Fly 223 EFALIMPNTGS 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpn | NP_476923.1 | HLH | 39..101 | CDD:238036 | 26/59 (44%) |
ORANGE | 114..158 | CDD:128787 | 15/56 (27%) | ||
Hes6 | NP_062352.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | 2/4 (50%) | |
bHLH_SF | 24..81 | CDD:412148 | 26/59 (44%) | ||
Hairy_orange | 96..134 | CDD:400076 | 13/37 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..209 | 17/78 (22%) | |||
WRPW motif | 221..224 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |