DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and hes2.1

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_021333940.1 Gene:hes2.1 / 559147 ZFINID:ZDB-GENE-081104-104 Length:195 Species:Danio rerio


Alignment Length:189 Identity:65/189 - (34%)
Similarity:93/189 - (49%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SNGYSDSYGSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTK 80
            :..:..|:||  ||:........|||||.||:||||||||||..||.||:|||..:.||.:|::|
Zfish     7 TEAHPHSFGS--RMTVAQRKEAHELRKTLKPLMEKRRRARINDSLNHLKTLILPLVGKDASRYSK 69

  Fly    81 LEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRL 145
            |||||||||||:.|:       ::...|.......:|.|:..|.:.::..:.| ..::|...||:
Zfish    70 LEKADILEMTVRFLR-------DLPSSSAKGQTDSYKEGYKACLQRISTMLPQ-SNLETEAHQRV 126

  Fly   146 SAHLNQ------------CANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQ 192
            |..:.|            ||.:.:.|..|.......|........::..|.   ||.||
Zfish   127 SEFIQQSMASSSSSCQNCCAQNSKMISQMHQRLVSLRNNNSMENPISTVPA---PSQPQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 40/61 (66%)
ORANGE 114..158 CDD:128787 11/55 (20%)
hes2.1XP_021333940.1 HLH 30..86 CDD:306515 38/62 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.