DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:211 Identity:63/211 - (29%)
Similarity:109/211 - (51%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSKA-ELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSV- 97
            :||. :.||..||::|::||||||.||::||.|::|.::::....|:||||||||:||.|::.: 
  Fly     5 MSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLK 69

  Fly    98 QRQQLNM-----AIQSDPSV-----VQKFKTGFVECAEEVNRYV---SQMDGIDTGVRQRLSAHL 149
            ||..|::     .:.|.|:.     |:.|::|:|..|:::.:.:   .|.|.|...:.:.||..|
  Fly    70 QRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRL 134

  Fly   150 NQCANSL------------EQI-GSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDL------N 195
            .:....|            :|| .|....:....||..||.|..|.....|.:...:|      :
  Fly   135 IELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVD 199

  Fly   196 NNSRTESSAPAIQMGG 211
            .|:.:|:::.:.|..|
  Fly   200 GNALSETASVSSQESG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 31/62 (50%)
ORANGE 114..158 CDD:128787 11/58 (19%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438344
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.