DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and helt

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_996948.1 Gene:helt / 404275 ZFINID:ZDB-GENE-040824-6 Length:270 Species:Danio rerio


Alignment Length:257 Identity:66/257 - (25%)
Similarity:100/257 - (38%) Gaps:72/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SKAELRK---TNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSV 97
            ||.:.||   .:..::|||||.|||.|||||...:..|:.|.  ...|||||:||||||::|:::
Zfish    52 SKMKDRKKTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQ--NSGKLEKAEILEMTVQYLRAL 114

  Fly    98 QRQQLNMAIQSDPSVVQ---KFKTGFVECAEEVNRYVSQMDGIDTGVRQ--RLSAHLNQCANSLE 157
            .........:....:.:   .|..|:.||.:.:..|::.::.::|...:  |:.|.|.....:..
Zfish   115 HSADFPRGREKGELLTEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKVVTEP 179

  Fly   158 QIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSG 222
            ..||:.              .::..||.|...|  :..:.|.|||   ..|..            
Zfish   180 VFGSLG--------------TISPDPTDLLCQL--EYQSPSPTES---VFQQS------------ 213

  Fly   223 EFALIMPNTGSAAPPPGPFAWPGSAAGVAAGTASAALASIANPTHLNDYTQSFRMSAFSKPV 284
                          |||.|:|..|       |.|..||..|...|          |.:..||
Zfish   214 --------------PPGHFSWHSS-------TRSPTLAYPAMSQH----------SGYLSPV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 29/64 (45%)
ORANGE 114..158 CDD:128787 9/48 (19%)
heltNP_996948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
HLH 62..115 CDD:278439 27/54 (50%)
Hairy_orange 136..173 CDD:284859 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.