DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and HELT

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001287710.1 Gene:HELT / 391723 HGNCID:33783 Length:242 Species:Homo sapiens


Alignment Length:305 Identity:77/305 - (25%)
Similarity:117/305 - (38%) Gaps:111/305 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELRKT--NKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQ--- 98
            |.::|  :..::|||||.|||.|||||...:..|:.|..:  .|||||:||||||::|:::.   
Human     7 ERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSS--GKLEKAEILEMTVQYLRALHSAD 69

  Fly    99 ----RQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQI 159
                |::..:..:    ....|..|:.||.:.:..|::.::.::|  :....|.:.....|..::
Human    70 FPRGREKAELLAE----FANYFHYGYHECMKNLVHYLTTVERMET--KDTKYARILAFLQSKARL 128

  Fly   160 GSMSNFSNGYRGGLFPATAVTAAPTPLFP---SLPQ-DLNNNSRTESSAPAIQMGGLQLIPSRLP 220
            |:                      .|.||   |||: |.:                .||.|:   
Human   129 GA----------------------EPAFPPLGSLPEPDFS----------------YQLHPA--- 152

  Fly   221 SGEFALIMPNTGSAAPPP-----GPFAWPGSAAGVAAGTASAALASIANPTHLNDYTQSFRMSAF 280
            ..|||...|  |.||..|     |||.||..||      .|.||..:.                 
Human   153 GPEFAGHSP--GEAAVFPQGSGAGPFPWPPGAA------RSPALPYLP----------------- 192

  Fly   281 SKPVNTSVPANLPENLIHTLPGQTQLPVKNSTSPPLSPISSISSH 325
            |.||..:.||                   ...||.|:|:..:..|
Human   193 SAPVPLASPA-------------------QQHSPFLTPVQGLDRH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 30/70 (43%)
ORANGE 114..158 CDD:128787 8/43 (19%)
HELTNP_001287710.1 bHLH-O_HELT 14..69 CDD:381414 27/56 (48%)
Hairy_orange 87..127 CDD:400076 8/41 (20%)
PRK14951 <133..>207 CDD:237865 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.