DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and HES5

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_005244808.1 Gene:HES5 / 388585 HGNCID:19764 Length:198 Species:Homo sapiens


Alignment Length:258 Identity:63/258 - (24%)
Similarity:92/258 - (35%) Gaps:113/258 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARH---TKLEKADILEMTVKHLQS 96
            ||..|..:..||::||.||.|||..:.:|| |:||   ::.|||   :||||||||||.|.:|:.
Human    11 LSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLE---QEFARHQPNSKLEKADILEMAVSYLKH 71

  Fly    97 VQRQQLNM---------------AIQSDP--------------SVVQKFKTGFVECAEEVNRYVS 132
            .:.::...               |.:|.|              |:.|.:..|:..|.:|..::::
Human    72 SKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLT 136

  Fly   133 QMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNN 197
            .....||  :.:|..|..:                           ..|||              
Human   137 LHAASDT--QMKLLYHFQR---------------------------PPAAP-------------- 158

  Fly   198 SRTESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAPPPGPFAWPGSAAGVAAGTASAALA 260
                 :|||.:                    |....|||||         |..|..||:||.|
Human   159 -----AAPAKE--------------------PKAPGAAPPP---------ALSAKATAAAAAA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 30/64 (47%)
ORANGE 114..158 CDD:128787 8/43 (19%)
HES5XP_005244808.1 HLH 14..71 CDD:238036 30/60 (50%)
Hairy_orange 118..153 CDD:295407 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.