Sequence 1: | NP_476923.1 | Gene: | dpn / 35800 | FlyBaseID: | FBgn0010109 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005244808.1 | Gene: | HES5 / 388585 | HGNCID: | 19764 | Length: | 198 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 63/258 - (24%) |
---|---|---|---|
Similarity: | 92/258 - (35%) | Gaps: | 113/258 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARH---TKLEKADILEMTVKHLQS 96
Fly 97 VQRQQLNM---------------AIQSDP--------------SVVQKFKTGFVECAEEVNRYVS 132
Fly 133 QMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNN 197
Fly 198 SRTESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAPPPGPFAWPGSAAGVAAGTASAALA 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpn | NP_476923.1 | HLH | 39..101 | CDD:238036 | 30/64 (47%) |
ORANGE | 114..158 | CDD:128787 | 8/43 (19%) | ||
HES5 | XP_005244808.1 | HLH | 14..71 | CDD:238036 | 30/60 (50%) |
Hairy_orange | 118..153 | CDD:295407 | 8/36 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140972 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |