DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and hes6

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:203 Identity:63/203 - (31%)
Similarity:97/203 - (47%) Gaps:33/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NSDDDFDCSNGYSDSYGSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMK 72
            |:.|:        |:||...             |||.||::||:||||||..|.||:.|:     
Zfish     8 NTHDE--------DNYGIKD-------------RKTRKPLVEKKRRARINESLQELRLLL----- 46

  Fly    73 KDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGI 137
            .||....|:|.|::||||||.::|:.:.:...|...:....::|..|:::|..||:.:||...||
Zfish    47 ADPDAQVKMENAEVLEMTVKRVESILQNKAKEADSVNREANERFAAGYIQCMHEVHTFVSSCPGI 111

  Fly   138 DTGVRQRLSAHLNQC--ANSLEQIGSMSN--FSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNS 198
            |..:...|..||.:|  .|..|:...:.:  .|:....|.:|..|..|..:|...|:   .|..|
Zfish   112 DATIAADLLNHLLECMPLNDEERFQDILSDLISDSNNSGTWPGEAAYATLSPGGTSV---ANGGS 173

  Fly   199 RTESSAPA 206
            ...|.||:
Zfish   174 SALSPAPS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 29/61 (48%)
ORANGE 114..158 CDD:128787 15/45 (33%)
hes6NP_919381.2 HLH 18..75 CDD:238036 29/74 (39%)
Hairy_orange 90..128 CDD:284859 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.