Sequence 1: | NP_476923.1 | Gene: | dpn / 35800 | FlyBaseID: | FBgn0010109 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_919381.2 | Gene: | hes6 / 373116 | ZFINID: | ZDB-GENE-030828-5 | Length: | 226 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 63/203 - (31%) |
---|---|---|---|
Similarity: | 97/203 - (47%) | Gaps: | 33/203 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 NSDDDFDCSNGYSDSYGSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMK 72
Fly 73 KDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGI 137
Fly 138 DTGVRQRLSAHLNQC--ANSLEQIGSMSN--FSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNS 198
Fly 199 RTESSAPA 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpn | NP_476923.1 | HLH | 39..101 | CDD:238036 | 29/61 (48%) |
ORANGE | 114..158 | CDD:128787 | 15/45 (33%) | ||
hes6 | NP_919381.2 | HLH | 18..75 | CDD:238036 | 29/74 (39%) |
Hairy_orange | 90..128 | CDD:284859 | 14/37 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |