DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and her15.2

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001099062.1 Gene:her15.2 / 359836 ZFINID:ZDB-GENE-070627-1 Length:149 Species:Danio rerio


Alignment Length:127 Identity:49/127 - (38%)
Similarity:69/127 - (54%) Gaps:17/127 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLI-LEAMKKDPARHTKLEKADILEMTVK 92
            |:..:.||..|..|..||::||.||.|||:|:.:|||:: .|..::||  :.||||||||||||.
Zfish     6 MTEYSKLSNKEKHKLRKPVVEKMRRDRINNCIEQLKSMLEKEFQQQDP--NAKLEKADILEMTVV 68

  Fly    93 HLQSVQRQQLNMAIQSDPSVVQKFK-TGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCA 153
            .|    :|||.      |...|..: .|:.:|..|...::|.  |.: .|.|||.....:.|
Zfish    69 FL----KQQLR------PKTPQNAQIEGYSQCWRETISFLSV--GSE-AVAQRLQQEARRSA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 31/62 (50%)
ORANGE 114..158 CDD:128787 11/41 (27%)
her15.2NP_001099062.1 HLH 19..72 CDD:278439 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.