DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and HES1

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens


Alignment Length:256 Identity:104/256 - (40%)
Similarity:145/256 - (56%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQL 102
            :|.||::|||||||||||||..|::||:|||:|:|||.:||:|||||||||||||||:::||.|:
Human    32 SEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQM 96

  Fly   103 NMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSN 167
            ..|:.:||||:.|::.||.||..||.|::|..:|::|.||.||..||   ||.:.||.:|:    
Human    97 TAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHL---ANCMTQINAMT---- 154

  Fly   168 GYRGGLFPAT---------------AVTAAPTPLFP----------SLPQDLNNNSRTESSAPAI 207
             |.|...||.               |..|.|.||.|          ..|..|.    :::...|.
Human   155 -YPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLG----SQAGEAAK 214

  Fly   208 QMGGLQLIPSRLPSGEFALIMPNTGSAAPPPGPFAWPG-------SAAGVAAGTASAALAS 261
            ..||.|::|:  |.|:||.::||        |.||..|       |.:|.:.|..:.:.:|
Human   215 VFGGFQVVPA--PDGQFAFLIPN--------GAFAHSGPVIPVYTSNSGTSVGPNAVSPSS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 45/61 (74%)
ORANGE 114..158 CDD:128787 19/43 (44%)
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 7/11 (64%)
bHLH-O_HES1_4 33..95 CDD:381465 45/61 (74%)
Hairy_orange 110..148 CDD:400076 18/40 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 9/42 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 2/12 (17%)
WRPW motif 275..278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7601
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 1 1.000 - - otm42263
orthoMCL 1 0.900 - - OOG6_105205
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3263
SonicParanoid 1 1.000 - - X3450
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.