DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and her8a

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:238 Identity:73/238 - (30%)
Similarity:113/238 - (47%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMT 90
            ||...|.|.   .|.||..||::||:||.|||..|.:||.::::|...|   .:||||||:||:|
Zfish     8 NGPEKNFNA---KEERKLRKPLIEKKRRERINSSLEQLKGIMVDAYNLD---QSKLEKADVLEIT 66

  Fly    91 VKHLQSVQRQQLNMAIQSDPSV----VQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQ 151
            |:|::::||.. .....:.|..    .|::.:|:::|..||:..:....|:|..:..||..||  
Zfish    67 VQHMENLQRGH-GQGGSNSPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHL-- 128

  Fly   152 CANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFP-----SLPQDLNNNSRTESSAPAIQMGG 211
                |:.:..:|...:|      .::|.|::|.||.|     :||..|             |...
Zfish   129 ----LKSLPHISTEPSG------TSSAGTSSPLPLSPTQSPINLPSSL-------------QPHA 170

  Fly   212 LQLIPSRLPSGEFALIMPNTGSAAP----PPGPFAWPGSAAGV 250
            |.|.||...|...:|:.|...|:.|    |..|.:.|....||
Zfish   171 LLLSPSPPSSPTHSLVRPREQSSPPSSPSPQSPASLPPFFPGV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 30/61 (49%)
ORANGE 114..158 CDD:128787 12/43 (28%)
her8aNP_955918.3 HLH 17..75 CDD:238036 28/60 (47%)
Hairy_orange 95..133 CDD:284859 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.