DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hes6

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001013197.1 Gene:Hes6 / 316626 RGDID:1312047 Length:234 Species:Rattus norvegicus


Alignment Length:216 Identity:63/216 - (29%)
Similarity:96/216 - (44%) Gaps:31/216 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GSNGRMSNP------NGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLE 82
            |...|:..|      .||| :...:..||::||:||||||..|.||:.|:.....:     .|||
  Rat    14 GQGLRVDGPAGGCTGQGLS-SRFPQARKPLVEKKRRARINESLQELRLLLAGTEVQ-----AKLE 72

  Fly    83 KADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSA 147
            .|::||:||:.:|...|.:.....|......::|..|:::|..||:.:||....||..|...|..
  Rat    73 NAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLN 137

  Fly   148 HL-------------NQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSR 199
            ||             :...:||..:...|..|:...|| .|.:.:::.|.| ...|..||.....
  Rat   138 HLLESMPLREGSSFRDLLGDSLAGLPGGSGRSSWPPGG-SPESPLSSPPGP-GDDLCSDLEEIPE 200

  Fly   200 TE-SSAPAIQMGGLQLIPSRL 219
            .| :..||   .|..|:|:.|
  Rat   201 AELNRVPA---EGPDLVPTSL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 24/61 (39%)
ORANGE 114..158 CDD:128787 15/56 (27%)
Hes6NP_001013197.1 HLH 37..85 CDD:238036 22/52 (42%)
Hairy_orange 106..144 CDD:284859 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.