DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and her2

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_005155978.1 Gene:her2 / 30300 ZFINID:ZDB-GENE-980526-274 Length:133 Species:Danio rerio


Alignment Length:95 Identity:37/95 - (38%)
Similarity:52/95 - (54%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELRKTNKPIMEKRRRARINHCLNELKSLILEAMK-KDPARHTKLEKADILEMTVKHLQSVQRQQL 102
            |..|..||::||.||.|||.|:.:||.|:...:| ..|.  :||||||||||.|.:|::..... 
Zfish    14 ERTKLRKPVVEKMRRDRINKCIEQLKILLKTEIKASQPC--SKLEKADILEMAVIYLKNTADAH- 75

  Fly   103 NMAIQSDPSVVQKFKTGFVECAEEVNRYVS 132
              |.....:..|.:..|:..|.||..|::|
Zfish    76 --ARSYSEAHAQSYADGYSRCIEETARFLS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 29/62 (47%)
ORANGE 114..158 CDD:128787 7/19 (37%)
her2XP_005155978.1 HLH 13..70 CDD:238036 29/57 (51%)
ORANGE 85..133 CDD:128787 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.