DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and her6

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio


Alignment Length:248 Identity:102/248 - (41%)
Similarity:143/248 - (57%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQL 102
            :|.||::|||||||||||||..|.:||:|||:|:|||.:||:|||||||||||||||:::||.|:
Zfish    32 SEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNMQRAQM 96

  Fly   103 NMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSN 167
            ..|:.:||:|:.|::.||.||..||.|::|..:|::|.||.||..||..|   :.||.:| |:..
Zfish    97 TAALNTDPTVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLASC---MTQINAM-NYPT 157

  Fly   168 GYRGGLFPATAVTAAPTPLFPSLPQDLN------------NNSRTESSAPAIQMGGLQLIPSRLP 220
            .::....|.....:.|....||..|..|            ::|...|.|..: .||.||:|:  .
Zfish   158 QHQIPAGPPHPSFSQPMVQIPSATQQANVVPLSGVPCKSGSSSNLTSDATKV-YGGFQLVPA--T 219

  Fly   221 SGEFALIMPNTGSAAPPPGPFAWPGSA--------AGVAAGTASAALASIANP 265
            .|:||.::||  :|..|.||.. |..|        ..|:.|..|....|:..|
Zfish   220 DGQFAFLIPN--AAFAPNGPVI-PVYANNSNTPVPVAVSPGAPSVTSDSVWRP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 45/61 (74%)
ORANGE 114..158 CDD:128787 18/43 (42%)
her6NP_571154.2 HLH 32..95 CDD:238036 45/62 (73%)
Hairy_orange 110..148 CDD:284859 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7581
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4258
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 1 1.000 - - otm26383
orthoMCL 1 0.900 - - OOG6_105205
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3263
SonicParanoid 1 1.000 - - X3450
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.