DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hes7

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_038941367.1 Gene:Hes7 / 287423 RGDID:1305914 Length:358 Species:Rattus norvegicus


Alignment Length:369 Identity:88/369 - (23%)
Similarity:124/369 - (33%) Gaps:139/369 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSD 109
            ||::|||||.|||..|.||:.|:||..:....|:.|||||:|||..|.:|:...|          
  Rat    46 KPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSR---------- 100

  Fly   110 PSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLF 174
                                  .:..|...||.||..|......|:....|:.|....|.  |..
  Rat   101 ----------------------VEPPGTARGVGQRREAGGWGARNARAGEGAGSEVDRGV--GER 141

  Fly   175 PATAVTAAPTPLFPSLPQDLNNNSRTESSA----------PA------IQMGGLQLIPSRLPSGE 223
            ||.            ||.::||.....|..          ||      .::..:.|.|:      
  Rat   142 PAV------------LPDEVNNTRACLSLCLPRCPPLHVHPASCLCLCARLTSVSLRPA------ 188

  Fly   224 FALIMPNTGSAAPPPGPFAWPGSAAGV--AAGTASAALASIANPTHLNDYTQS-FRMSAFSKPVN 285
                 |:.....|.|.|...|.:|.||  :.|..:.||||    .:|:.:.:. .|::||:...:
  Rat   189 -----PSLNPVGPLPRPPVLPPAAPGVPRSPGQDAEALAS----CYLSGFRECLLRLAAFAHDAS 244

  Fly   286 TSVPANL--------------PENLIHTLPGQTQLPVKNSTSPPLSPISSI-------------- 322
            .:..:.|              ||.....||         :..|||.|.|.|              
  Rat   245 PAARSQLFSALNGYRRPKPPRPEAADPGLP---------APRPPLDPASPILGPALHQRPPVHQG 300

  Fly   323 ---------SSHCE----ESRAASPTVDVMSKHSFAGVFSTPPP 353
                     .|||.    :|.|.:|         ..|:...|||
  Rat   301 PPSPRLAWSPSHCSPRAGDSGAPAP---------LTGLLPPPPP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 28/55 (51%)
ORANGE 114..158 CDD:128787 7/43 (16%)
Hes7XP_038941367.1 bHLH-O_HES7 44..102 CDD:381468 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.