DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and HEYL

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_055386.2 Gene:HEYL / 26508 HGNCID:4882 Length:328 Species:Homo sapiens


Alignment Length:334 Identity:95/334 - (28%)
Similarity:147/334 - (44%) Gaps:75/334 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SNGYSD---SYGSNGR-------MSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEA 70
            |:|.||   ..|..|:       :|.|:. |:.:.||.::.|:|||||.|||..|:||:.|:..|
Human    10 SDGESDGPIDVGQEGQLSQMARPLSTPSS-SQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTA 73

  Fly    71 MKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMD 135
            .:|..:  :|||||::|:|||.||:.:..........:....|.....||.||..||.||:..::
Human    74 FEKQGS--SKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLE 136

  Fly   136 GIDT---GVRQRLSAHLNQCANSLE----QIGSMS------NFSNGYRGGLFPATAVTAA----- 182
            |..:   .||.||.:|||..|..:|    ..|.::      :|.:...|  .||.:...|     
Human   137 GPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPG--LPALSNQLAILGRV 199

  Fly   183 PTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAPPPGPFAWPGSA 247
            |:|:.|.:            |:||..:..|:..|.|..:|   :|:|...:..|..|        
Human   200 PSPVLPGV------------SSPAYPIPALRTAPLRRATG---IILPARRNVLPSRG-------- 241

  Fly   248 AGVAAGTASA-ALASIANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTLPGQT------Q 305
               |:.|..| .|...|.|..:...:::.|.|..:..:.:|.|         |.||.|      .
Human   242 ---ASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSSP---------TPPGPTGSAAYVA 294

  Fly   306 LPVKNSTSP 314
            :|..||:||
Human   295 VPTPNSSSP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 28/61 (46%)
ORANGE 114..158 CDD:128787 18/50 (36%)
HEYLNP_055386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 16/47 (34%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 28/70 (40%)
HLH 42..100 CDD:238036 28/59 (47%)
ORANGE 115..162 CDD:128787 17/46 (37%)
Atrophin-1 <136..311 CDD:331285 49/205 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..308 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.