DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Helt

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_006509452.1 Gene:Helt / 234219 MGIID:3040955 Length:241 Species:Mus musculus


Alignment Length:298 Identity:73/298 - (24%)
Similarity:120/298 - (40%) Gaps:98/298 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELRKT--NKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQ--- 98
            |.::|  :..::|||||.|||.|||||...:..|:.|..:  .|||||:||||||::|:::.   
Mouse     7 ERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSS--GKLEKAEILEMTVQYLRALHSAD 69

  Fly    99 ----RQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQI 159
                |::..:..:    ....|..|:.||.:.:..|::.::.::|  :....|.:.....|..::
Mouse    70 FPRGREKAELLAE----FANYFHYGYHECMKNLVHYLTTVERMET--KDTKYARILAFLQSKARL 128

  Fly   160 GSMSNFSNGYRGGLFPATAVTAAPTPLFP--SLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSG 222
            |:                      .|.||  |||:. :.:.:..:::|.        .|...| |
Mouse   129 GA----------------------EPTFPPLSLPEP-DFSYQLHAASPE--------FPGHSP-G 161

  Fly   223 EFALIMPNTGSAAPPPGPFAWPGSAAGVAAGTASAALASIANPTHLNDYTQSFRMSAFSKPVNTS 287
            | |.:.|...:    ||.|.||..||      .|.||..:::.|                     
Mouse   162 E-ATMFPQGAT----PGSFPWPPGAA------RSPALPYLSSAT--------------------- 194

  Fly   288 VPANLPENLIHTLPGQTQLPVKNSTSPPLSPISSISSH 325
            ||          ||...|     ..||.|:|:..:..|
Mouse   195 VP----------LPSPAQ-----QHSPFLAPMQGLDRH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 30/70 (43%)
ORANGE 114..158 CDD:128787 8/43 (19%)
HeltXP_006509452.1 bHLH-O_HELT 14..69 CDD:381414 27/56 (48%)
Hairy_orange 87..127 CDD:369405 8/41 (20%)
PLN02983 <147..>213 CDD:215533 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.