DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and lin-22

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_500281.1 Gene:lin-22 / 177082 WormBaseID:WBGene00003008 Length:173 Species:Caenorhabditis elegans


Alignment Length:194 Identity:51/194 - (26%)
Similarity:91/194 - (46%) Gaps:32/194 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FDCSNGYSDSYGSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPAR 77
            |.||:...:|.|         |:|:.:..| |||:|||:||||||..|::||.::::...|:..:
 Worm     4 FLCSDTEIESDG---------GISRCKKIK-NKPLMEKKRRARINKSLSQLKQILIQDEHKNSIQ 58

  Fly    78 HTKLEKADILEMTVKHLQSVQRQQ------LNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDG 136
            |:|.||||||||.|::||.::..|      ...:|.:.|:.           .||:......::.
 Worm    59 HSKWEKADILEMAVEYLQQLRSAQPCSLSPSTSSISTPPTP-----------KEEIRNIKVPLNP 112

  Fly   137 IDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRT 200
            |.:.:...:..::     :.:|:..:|.::..:...........|..|...|.|.:.|....|:
 Worm   113 IASFLNPMMQQYV-----AYQQLAQLSMYTQLFNNPAGVPLRADAGVTAQSPELAEKLKIEDRS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 30/61 (49%)
ORANGE 114..158 CDD:128787 3/43 (7%)
lin-22NP_500281.1 bHLH_O_HES 29..82 CDD:381416 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6616
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4933
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 1 1.000 - - oto19460
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3263
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.