DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hey2

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_569101.1 Gene:Hey2 / 155430 RGDID:621405 Length:339 Species:Rattus norvegicus


Alignment Length:333 Identity:104/333 - (31%)
Similarity:154/333 - (46%) Gaps:39/333 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KNDINSDDDFDCSNGYSDSYGSNGRMSN-PNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLI 67
            ::|::...|....|.||....|:...|| |...|:...||..:.|:|||||.|||:.|:||:.|:
  Rat    11 ESDLDETIDVGSENNYSGHSASSVMRSNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLV 75

  Fly    68 LEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVS 132
            ..|.:|..:  .|||||:||:|||.||:.:|.........:..........||.||..||.||:|
  Rat    76 PTAFEKQGS--AKLEKAEILQMTVDHLKMLQATGGKGYFDAHALATDFMSIGFRECLTEVARYLS 138

  Fly   133 QMDGIDTG--VRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFP---ATAVTAAPTPLFPSLPQ 192
            .::|:|..  :|.||.:||:.||:..|.....|:.|: :...|.|   |.|....||.|..  |.
  Rat   139 SVEGLDPSDPLRVRLVSHLSTCASQREAAVMTSSMSH-HHHPLHPHHWAAAFHHLPTSLLQ--PN 200

  Fly   193 DLNNNS----RTESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAP--PPGPFAWPGSAAGVA 251
            .|:.:.    |..:|:......|..|:.:.....:.||.||:||:.||  ||...:....:|.|.
  Rat   201 GLHTSESTPCRLSTSSEVPPAHGSALLTATFAHADSALRMPSTGTVAPCVPPLSTSLLSLSATVH 265

  Fly   252 AGTASAALASIANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTLPGQTQLPVKNSTSPPL 316
            |..|:|..|:.:.|.   .:..:|.|              ||.|    ......:....:.||||
  Rat   266 AAAAAATAAAHSFPL---SFAGAFPM--------------LPSN----AAAAAAVAAATAISPPL 309

  Fly   317 SPISSISS 324
            | :|:.||
  Rat   310 S-VSAASS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 30/61 (49%)
ORANGE 114..158 CDD:128787 18/45 (40%)
Hey2NP_569101.1 HLH 49..105 CDD:238036 29/57 (51%)
ORANGE 120..165 CDD:128787 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4791
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.