DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Hes5

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus


Alignment Length:200 Identity:52/200 - (26%)
Similarity:83/200 - (41%) Gaps:58/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARH---TKLEKADILEMTVKHLQS 96
            ||..|..:..||::||.||.|||..:.:|| |:||   ::.|||   :||||||||||.|.:|:.
Mouse   229 LSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLE---QEFARHQPNSKLEKADILEMAVSYLKH 289

  Fly    97 VQ--------------------------RQQLNMAIQSDP-SVVQKFKTGFVECAEEVNRYVSQM 134
            .:                          |.....|..:.| |:.|.:..|:..|.:|..::::..
Mouse   290 SKGEPGACARLLLPADVAPTARAPLMPLRLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLH 354

  Fly   135 DGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSR 199
            ...||  :.:|..|..:.                      ||.|..|...|...:.||...::::
Mouse   355 AASDT--QMKLLYHFQRP----------------------PAPAAPAKEPPAPGAAPQPARSSAK 395

  Fly   200 TESSA 204
            ..::|
Mouse   396 AAAAA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 31/90 (34%)
ORANGE 114..158 CDD:128787 8/43 (19%)
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 29/59 (49%)
ORANGE 334..369 CDD:128787 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.