Sequence 1: | NP_476923.1 | Gene: | dpn / 35800 | FlyBaseID: | FBgn0010109 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006538625.3 | Gene: | Hes5 / 15208 | MGIID: | 104876 | Length: | 415 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 52/200 - (26%) |
---|---|---|---|
Similarity: | 83/200 - (41%) | Gaps: | 58/200 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 LSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARH---TKLEKADILEMTVKHLQS 96
Fly 97 VQ--------------------------RQQLNMAIQSDP-SVVQKFKTGFVECAEEVNRYVSQM 134
Fly 135 DGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSR 199
Fly 200 TESSA 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpn | NP_476923.1 | HLH | 39..101 | CDD:238036 | 31/90 (34%) |
ORANGE | 114..158 | CDD:128787 | 8/43 (19%) | ||
Hes5 | XP_006538625.3 | bHLH-O_HES5 | 236..292 | CDD:381467 | 29/59 (49%) |
ORANGE | 334..369 | CDD:128787 | 8/36 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830927 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |